DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CLEC4C

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001358319.1 Gene:CLEC4C / 170482 HGNCID:13258 Length:213 Species:Homo sapiens


Alignment Length:137 Identity:34/137 - (24%)
Similarity:50/137 - (36%) Gaps:33/137 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRY--------------W 164
            |..|:|....: :|..:...|..||..|..:.::||.|.....|...:.|              |
Human    92 SSCYFISTGMQ-SWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQW 155

  Fly   165 IDVTNQFNESEFVSVTKGSKANFLSWADGEPTK-DGEC--VDIRTFNGKTTMNDNSCFANLYFIC 226
            :|.| .:||            |...|..|||.. |..|  ::.|: :.:...||..|......||
Human   156 VDQT-PYNE------------NVTFWHSGEPNNLDERCAIINFRS-SEEWGWNDIHCHVPQKSIC 206

  Fly   227 E-KSIEI 232
            : |.|.|
Human   207 KMKKIYI 213

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/129 (23%)
CLEC4CNP_001358319.1 CLECT_DC-SIGN_like 83..208 CDD:153060 31/130 (24%)
Carbohydrate binding. /evidence=ECO:0000269|PubMed:25995448, ECO:0007744|PDB:4ZET 184..186 0/1 (0%)