DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Klra1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_057868.2 Gene:Klra1 / 16627 MGIID:101907 Length:262 Species:Mus musculus


Alignment Length:186 Identity:41/186 - (22%)
Similarity:66/186 - (35%) Gaps:40/186 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IALNDRRLDNFGTSTNLQLENQNTSQQLLTHGTA--------MGRKLEENEIFQQLGSKYYYIEK 121
            |.|.|..|.|.....:| ||:.|..|..|.:.|.        .||  .:...:...|.|.||...
Mouse    94 INLKDEMLKNKSIECDL-LESLNRDQNRLYNKTKTVLDSLQHTGR--GDKVYWFCYGMKCYYFVM 155

  Fly   122 EEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKAN 186
            :.| .|......|......|..:..::|| :|...:...:..|            |.::..:|..
Mouse   156 DRK-TWSGCKQTCQSSSLSLLKIDDEDEL-KFLQLVVPSDSCW------------VGLSYDNKKK 206

  Fly   187 FLSWADGEPTK-----------DGECVDIRTFNGKTTMNDNSCFANLYFICEKSIE 231
            ..:|.|..|:|           ||.|:.:    .||.:::.:|......||.|.::
Mouse   207 DWAWIDNRPSKLALNTRKYNIRDGGCMLL----SKTRLDNGNCDQVFICICGKRLD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 24/122 (20%)
Klra1NP_057868.2 Ly49 40..153 CDD:285577 17/61 (28%)
Cell attachment site 137..139 1/3 (33%)
CLECT_NK_receptors_like 142..255 CDD:153063 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.