DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CLEC4F

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_011530937.1 Gene:CLEC4F / 165530 HGNCID:25357 Length:699 Species:Homo sapiens


Alignment Length:217 Identity:54/217 - (24%)
Similarity:81/217 - (37%) Gaps:55/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SSSYSAACEGVESDSQCAAYCYGVLNPCIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTST 79
            :|:.::..:.::|:.|.|:          |.:..|:..:|..:|..  ..|.....||.......
Human   510 ASALTSQTQMLDSNLQKAS----------AEIQRLRGDLENTKALT--MEIQQEQSRLKTLHVVI 562

  Fly    80 NLQLENQNTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASL 144
            ..|.:.|.|..||| .....|.|...       ||.||:  ...|.:||:|...|...|.||||:
Human   563 TSQEQLQRTQSQLL-QMVLQGWKFNG-------GSLYYF--SSVKKSWHEAEQFCVSQGAHLASV 617

  Fly   145 QSQEE---LDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDGECVDIRT 206
            .|:||   |..|.:::    .|||.:|::..|..:            .|.||.|           
Human   618 ASKEEQAFLVEFTSKV----YYWIGLTDRGTEGSW------------RWTDGTP----------- 655

  Fly   207 FN---GKTTMNDNSCFANLYFI 225
            ||   .|...:..||....|.|
Human   656 FNAAQNKAPGSKGSCPLRKYII 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/116 (28%)
CLEC4FXP_011530937.1 Lebercilin 374..556 CDD:292252 10/57 (18%)
CLECT_DC-SIGN_like 581..>657 CDD:153060 30/111 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.