DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and NCAN

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_004377.2 Gene:NCAN / 1463 HGNCID:2465 Length:1321 Species:Homo sapiens


Alignment Length:234 Identity:58/234 - (24%)
Similarity:86/234 - (36%) Gaps:32/234 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PLCLSSSYSAACEGVESDSQCAAYCYGVLNPCI-ASMGNLQRRVEACEAAVAIA----RIALND- 69
            |....:..:|..|.|.||.     |..  |||: ....|....:..|......|    .|.::| 
Human   993 PALPGTPMNAGAEEVHSDP-----CEN--NPCLHGGTCNANGTMYGCSCDQGFAGENCEIDIDDC 1050

  Fly    70 --RRLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEEN-----EIFQQLGSKYYYIEKEEKLNW 127
              ...:|.||.  :...|......|.::|.:...|..|.     ..||  |..|.|.  ..:..|
Human  1051 LCSPCENGGTC--IDEVNGFVCLCLPSYGGSFCEKDTEGCDRGWHKFQ--GHCYRYF--AHRRAW 1109

  Fly   128 HDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWAD 192
            .||...|.:..|||.|:.|.||....|:  .|....||.:.::..|.:| ..|..:...|.:|.:
Human  1110 EDAEKDCRRRSGHLTSVHSPEEHSFINS--FGHENTWIGLNDRIVERDF-QWTDNTGLQFENWRE 1171

  Fly   193 GEPTK---DGECVDIRTFNGKTTMNDNSCFANLYFICEK 228
            .:|..   .||...:...:.....||..|..||.::|:|
Human  1172 NQPDNFFAGGEDCVVMVAHESGRWNDVPCNYNLPYVCKK 1210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/114 (27%)
NCANNP_004377.2 Ig_Neurocan 51..161 CDD:143310
Link_domain_CSPGs_modules_1_3 160..254 CDD:239594
Link_domain_CSPGs_modules_2_4 261..356 CDD:239597
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 456..479
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 494..513
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..579
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 682..731
O-glycosylated at one site 708..712
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 820..844
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 876..955
EGF 1012..1042 CDD:278437 7/31 (23%)
EGF_CA 1046..1082 CDD:238011 7/37 (19%)
CLECT 1088..1211 CDD:295302 35/130 (27%)
CCP 1215..1271 CDD:153056
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1275..1321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.