DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Fcer2a

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_006508760.1 Gene:Fcer2a / 14128 MGIID:95497 Length:335 Species:Mus musculus


Alignment Length:174 Identity:51/174 - (29%)
Similarity:77/174 - (44%) Gaps:15/174 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VAIARIALNDRRLDNFGTSTNLQLENQNTS----QQLLTHGTAMGRKLEENEIFQQLGSKYYYIE 120
            |.|..:.||::|.    .|.:|:...:..:    :.|::.|||.....:....|||   |.||..
Mouse   148 VNIKSLGLNEKRT----ASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQ---KCYYFG 205

  Fly   121 KEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKA 185
            |..| .|..|...|..:.|.|.|:.||:|.|.....:|..:. ||.:.:...|.||| .:.||..
Mouse   206 KGSK-QWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDS-WIGLQDLNMEGEFV-WSDGSPV 267

  Fly   186 NFLSWADGEPTKDGECVDIRTFNGKTTMNDNSCFANL-YFICEK 228
            .:.:|..|||...|:..|.....|....||..|.:.| .::||:
Mouse   268 GYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 35/112 (31%)
Fcer2aXP_006508760.1 SH3_and_anchor <77..>175 CDD:275056 7/30 (23%)
CLECT_DC-SIGN_like 190..310 CDD:153060 38/125 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.