DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CHODL

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_011527755.1 Gene:CHODL / 140578 HGNCID:17807 Length:277 Species:Homo sapiens


Alignment Length:143 Identity:30/143 - (20%)
Similarity:56/143 - (39%) Gaps:29/143 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 YYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNR---------YWIDVTNQFN 172
            |:.|...::::.:|...|...||.|.||:::.|.....:.|..|.:         :||.:....:
Human    44 YFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGD 108

  Fly   173 ES------EFVSVTKGSKANFLSWADGEPTKDGE-CVDIRTFNGKTT-----------MNDNSCF 219
            ..      :....:.||.:.:.:|...||:...| ||.:  ::..|.           .||:.|.
Human   109 GQTSGACPDLYQWSDGSNSQYRNWYTDEPSCGSEKCVVM--YHQPTANPGLGGPYLYQWNDDRCN 171

  Fly   220 ANLYFICEKSIEI 232
            ....:||:...||
Human   172 MKHNYICKYEPEI 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 28/137 (20%)
CHODLXP_011527755.1 CLECT 28..180 CDD:295302 28/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.