DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CTL4

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_315348.2 Gene:CTL4 / 1276043 VectorBaseID:AGAP005335 Length:177 Species:Anopheles gambiae


Alignment Length:169 Identity:39/169 - (23%)
Similarity:58/169 - (34%) Gaps:50/169 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 TSQQLLTH-------GTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQ 145
            |:::::|.       |...|.||              |.....:|||.||:..|..:|..:|:::
Mosquito    29 TAREMITQNLCVCPCGNPRGGKL--------------YTTPNLRLNWFDAVSYCSSIGMSIATIK 79

  Fly   146 SQEELDRFNNQLNGLNR-----------YWIDVTNQF-NESEFVSVTKGSKANFLSWADG----- 193
            ...|.......|:|..|           |||...:.. .:.....:|.........||||     
Mosquito    80 DTNERQLLQLHLDGDRRLTRSQKRSKIPYWIGANSLIAGQGLRWGLTDQEVKESAEWADGIAPAN 144

  Fly   194 ---EPTKDGECVDIR--TFNGKTTMNDNSCFANLYFICE 227
               ||.    ||.|:  |.:...|..|:.   ...||||
Mosquito   145 NRVEPF----CVYIQGSTMSWVATSCDDE---PRQFICE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/134 (25%)
CTL4XP_315348.2 CLECT 58..177 CDD:153057 32/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.