DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CTL8

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_313387.4 Gene:CTL8 / 1274289 VectorBaseID:AGAP003625 Length:190 Species:Anopheles gambiae


Alignment Length:153 Identity:34/153 - (22%)
Similarity:56/153 - (36%) Gaps:37/153 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 QLGSKYYYIEK----EEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLN----GLNRYWIDV 167
            ||....|:|.:    ..:||:..|...|..:|..|||.:::|:::.....|.    |...:|.. 
Mosquito    24 QLDGVQYFISRMNPYSPELNYFLAYQYCRSLGLQLASFETKEKVESMTEYLQNAGYGKYNFWTS- 87

  Fly   168 TNQFNESEFVSVTKGSKAN-FLSWADGEPTKDGECVDIRTFNGKT----TMNDNS---------- 217
            .|:.....|:.::.|...| ...:.:..|...|  :|....|..|    |..|:|          
Mosquito    88 GNRLGTGMFLWMSTGLPFNATFDYFEKSPETVG--MDPLDHNSNTSPQRTARDSSSGLQKGCVHL 150

  Fly   218 -----------CFANLYFICEKS 229
                       |.|...||||::
Mosquito   151 KAPSLRWAPEDCSAVKDFICEQT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/145 (21%)
CTL8XP_313387.4 CLECT 41..172 CDD:153057 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.