DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Asgr2

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001300854.1 Gene:Asgr2 / 11890 MGIID:88082 Length:301 Species:Mus musculus


Alignment Length:199 Identity:51/199 - (25%)
Similarity:80/199 - (40%) Gaps:54/199 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LDNFGTSTN-------LQLENQNTSQQL-LTHGTAMGR----KLEENEIFQQL------------ 112
            ||..|.|||       .|||.:  .||| ..|.|.:..    .::...:..||            
Mouse   109 LDTLGGSTNAILTSWLAQLEEK--QQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCP 171

  Fly   113 -------GSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELD---RFNNQLNGLNRYWIDV 167
                   ||.|::  ..:.|.|.:|...|.....||..:.|:||.|   :..:|.:    .||.:
Mouse   172 VNWVEFGGSCYWF--SRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFH----IWIGL 230

  Fly   168 TNQFNESEFVSVTKGSKANFLSWADGEPTK-------DGE-CVDIRTFNGKTTMNDNSCFANLYF 224
            |::....::|..| ..::|:.:||..:|..       .|| |.:|.: :|.  .|||.|.....:
Mouse   231 TDRDGSWKWVDGT-DYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILS-DGH--WNDNFCQQVNRW 291

  Fly   225 ICEK 228
            :|||
Mouse   292 VCEK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/122 (25%)
Asgr2NP_001300854.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Lectin_N 29..162 CDD:281887 16/54 (30%)
CLECT_DC-SIGN_like 170..295 CDD:153060 33/134 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.