Sequence 1: | NP_001356891.1 | Gene: | CG7763 / 36235 | FlyBaseID: | FBgn0040503 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001278060.1 | Gene: | Asgr1 / 11889 | MGIID: | 88081 | Length: | 284 | Species: | Mus musculus |
Alignment Length: | 248 | Identity: | 48/248 - (19%) |
---|---|---|---|
Similarity: | 86/248 - (34%) | Gaps: | 80/248 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 CIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLE-- 104
Fly 105 ENEIFQQL-------------------------------------------------GSKYYYIE 120
Fly 121 KEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKA 185
Fly 186 NFLSWADGEPTK-------DGECVDIRTFNGKTTMNDNSCFANLYFICEKSIE 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7763 | NP_001356891.1 | CLECT | 116..228 | CDD:153057 | 27/118 (23%) |
Asgr1 | NP_001278060.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..25 | ||
Endocytosis signal. /evidence=ECO:0000255 | 5..8 | ||||
Lectin_N | 15..143 | CDD:397859 | 18/102 (18%) | ||
CLECT_DC-SIGN_like | 153..278 | CDD:153060 | 29/130 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |