DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Asgr1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001278060.1 Gene:Asgr1 / 11889 MGIID:88081 Length:284 Species:Mus musculus


Alignment Length:248 Identity:48/248 - (19%)
Similarity:86/248 - (34%) Gaps:80/248 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLE-- 104
            |:.:..|.|.|.:.         :||.    .||   :||.:..::..:.|.|.|:::|||::  
Mouse    56 CVITSQNSQLREDL---------LALR----QNF---SNLTVSTEDQVKALSTQGSSVGRKMKLV 104

  Fly   105 ENEIFQQL-------------------------------------------------GSKYYYIE 120
            |:::.:|.                                                 ||.|::..
Mouse   105 ESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSS 169

  Fly   121 KEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKA 185
            ....  |.:|...|.....||..:.|::|.:.....:..||. ||.:|:|....::|..| ..:.
Mouse   170 SVRP--WTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNT-WIGLTDQNGPWKWVDGT-DYET 230

  Fly   186 NFLSWADGEPTK-------DGECVDIRTFNGKTTMNDNSCFANLYFICEKSIE 231
            .|.:|...:|..       .||  |...|......||:.|.....::||..::
Mouse   231 GFQNWRPEQPDNWYGHGLGGGE--DCAHFTTDGRWNDDVCRRPYRWVCETKLD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 27/118 (23%)
Asgr1NP_001278060.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 15..143 CDD:397859 18/102 (18%)
CLECT_DC-SIGN_like 153..278 CDD:153060 29/130 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.