DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and LOC116412330

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_031762306.1 Gene:LOC116412330 / 116412330 -ID:- Length:393 Species:Xenopus tropicalis


Alignment Length:132 Identity:30/132 - (22%)
Similarity:55/132 - (41%) Gaps:33/132 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFV 177
            |:..|::..:.: ||..:|.:|...|||||.:.|.||.:...:.:..::  ||.::::..|.:: 
 Frog   267 GASCYFLHLDSQ-NWEISLKRCQMQGGHLAVITSLEEQNFLKSMVKNVS--WIGLSDRKKEGDW- 327

  Fly   178 SVTKGSKANFLSWADGEPTKDG---------------ECVDIRTFNGKTTMNDNSCFANLYFICE 227
                       .||||.|....               :||   |.:.....||:.|......:||
 Frog   328 -----------RWADGTPYNSAPKFWQPNQPDNRGNEDCV---TLSPGWLWNDDKCRKPYNSVCE 378

  Fly   228 KS 229
            ::
 Frog   379 RN 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 28/126 (22%)
LOC116412330XP_031762306.1 CLECT_DC-SIGN_like 259..379 CDD:153060 29/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11019
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.