DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Clec4f

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_446205.1 Gene:Clec4f / 114598 RGDID:621062 Length:550 Species:Rattus norvegicus


Alignment Length:239 Identity:56/239 - (23%)
Similarity:109/239 - (45%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SSSYSAACEGVESDSQCAAYCYGVLNPCIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTST 79
            :||.::..|.|....:.::.....|...::.:..|:..|:..::.:..|:..:...:.....|.|
  Rat   312 TSSLNSQIEVVNGKLKDSSRELQTLRRDLSDVSALKSNVQMLQSNLQKAKAEVQSLKTGLEATKT 376

  Fly    80 -NLQLENQNTSQQLLTHGTA---MGRKLEENEIFQQL-------GSKYYYIEKEEKLNWHDALDK 133
             ..:::.|.:..:.|....|   .|:| .:|::.|.:       ..|:||..:::| :||:|.:.
  Rat   377 LAAKIQGQQSDLEALQKAVAAHTQGQK-TQNQVLQLIMQDWKYFNGKFYYFSRDKK-SWHEAENF 439

  Fly   134 CHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLS----WADGE 194
            |...|.||||:.|||| ..|..|:.....:||.:|:|..|..:..| .|:..:::.    |..|:
  Rat   440 CVSQGAHLASVTSQEE-QAFLVQITNAVDHWIGLTDQGTEGNWRWV-DGTPFDYVQSRRFWRKGQ 502

  Fly   195 PTK----DGE---CVDIRTFNGKTTMNDNSCFANLYFICEKSIE 231
            |..    :||   ||.::..     .||.:|.....::|:||.:
  Rat   503 PDNWRHGNGEREDCVHLQRM-----WNDMACGTAYNWVCKKSTD 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 36/122 (30%)
Clec4fNP_446205.1 SMC_prok_B <100..390 CDD:274008 11/77 (14%)
CLECT_DC-SIGN_like 414..538 CDD:153060 37/131 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11467
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.