DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and Vcan

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001164029.1 Gene:Vcan / 114122 RGDID:619940 Length:3357 Species:Rattus norvegicus


Alignment Length:240 Identity:57/240 - (23%)
Similarity:85/240 - (35%) Gaps:70/240 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CLS--------SSYSAACEGVESDSQCAA---YCYGVLNPCIASMGNLQRRVEACEAAVAIARIA 66
            ||:        :||...|....|..||..   .|:.  |||        |....|          
  Rat  3059 CLNGGTCYPTETSYVCTCAPGYSGDQCELDFDECHS--NPC--------RNGATC---------- 3103

  Fly    67 LNDRRLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEEN--------EIFQQLGSKYYYIEKEE 123
                 :|...|...|.|.:.            :|...|::        ..||....||:    ..
  Rat  3104 -----VDGLNTFRCLCLPSY------------VGALCEQDTETCDYGWHKFQGQCYKYF----AH 3147

  Fly   124 KLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFL 188
            :..|..|..:|...|.||.|:.|.|| ..|.|:: |.:..||.:.::..|.:| ..|.||...:.
  Rat  3148 RRTWDAAERECRLQGAHLTSILSHEE-QMFVNRV-GHDYQWIGLNDKMFEHDF-RWTDGSALQYE 3209

  Fly   189 SWADGEP----TKDGECVDIRTF-NGKTTMNDNSCFANLYFICEK 228
            :|...:|    :...:||.|... ||:  .||..|..:|.:.|:|
  Rat  3210 NWRPNQPDSFFSAGEDCVVIIWHENGQ--WNDVPCNYHLTYTCKK 3252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/116 (28%)
VcanNP_001164029.1 IG_like 30..147 CDD:214653
Ig_Versican 36..151 CDD:143309
Link_domain_CSPGs_modules_1_3 150..244 CDD:239594
Link_domain_CSPGs_modules_2_4 251..346 CDD:239597
EGF_CA 3052..3086 CDD:238011 7/26 (27%)
EGF_CA 3088..3124 CDD:238011 11/72 (15%)
CLECT_CSPGs 3130..3253 CDD:153058 37/132 (28%)
CCP 3257..3313 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.