DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CLEC4M

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_055072.3 Gene:CLEC4M / 10332 HGNCID:13523 Length:399 Species:Homo sapiens


Alignment Length:218 Identity:51/218 - (23%)
Similarity:93/218 - (42%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YGVLNPCIASMGNLQRR-------VEACEAAVAIARIALNDRRLDNFGTSTNL-----QLENQNT 88
            |..|....|::|.|..:       .|..|...|:..:....:..:.:...|.|     :|.:|:.
Human   182 YQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSK 246

  Fly    89 SQQLLTHGTAMGRKLE--------ENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQ 145
            .||:....|.:....|        :...||   ...|::...:: ||||::..|.::...|..::
Human   247 QQQIYQELTDLKTAFERLCRHCPKDWTFFQ---GNCYFMSNSQR-NWHDSVTACQEVRAQLVVIK 307

  Fly   146 SQEELDRFNNQLNGLNRY-WIDVT--NQFNESEFVSVTKGSKANFLSWADGEPTKDG--ECVDIR 205
            :.||.:....|.:..||: |:.::  ||....::|..:..|.:....|..|||...|  :|.:  
Human   308 TAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAE-- 370

  Fly   206 TFNGKTTMNDNSCFANLYFICEK 228
             |:| :..|||.|..:.|:||:|
Human   371 -FSG-SGWNDNRCDVDNYWICKK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 32/116 (28%)
CLEC4MNP_055072.3 Endocytosis signal. /evidence=ECO:0000250 14..15
transmembrane domain 44..71
7 X approximate tandem repeats 108..269 16/86 (19%)
DUF342 <140..251 CDD:302792 14/68 (21%)
CLECT_DC-SIGN_like 268..391 CDD:153060 34/130 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.