DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and si:ch73-111e15.1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_005172686.1 Gene:si:ch73-111e15.1 / 101885260 ZFINID:ZDB-GENE-110411-28 Length:271 Species:Danio rerio


Alignment Length:181 Identity:47/181 - (25%)
Similarity:74/181 - (40%) Gaps:50/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TNLQLENQNTSQQLLTHGTAMGRKLEENE-IFQQ---------LGSKYYYIEKEEKLNWHDALDK 133
            ||| .||::   :|||:   :...|::.| :.||         ..|.:||:..|.| :|.|:...
Zfish   107 TNL-TENKD---ELLTN---IENLLKDREQLIQQHQIIAGWTYFQSSFYYLSNESK-SWTDSRGD 163

  Fly   134 CHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPTKD 198
            |......|.::.:::|.| |...|.....:||.:|:...|.::            .|.||.....
Zfish   164 CKGRKADLITINNRQEQD-FVMTLTRNKEFWIGLTDSEKEGQW------------KWVDGSTLTT 215

  Fly   199 GECVDIRTF---NGKTTMN----------------DNSCFANLYFICEKSI 230
            |.....|:.   ||.|..|                |::|.|:..:||||||
Zfish   216 GFWASFRSITEPNGGTRENCVLTHLKRHPELIGWIDHNCDASYQWICEKSI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/130 (23%)
si:ch73-111e15.1XP_005172686.1 CLECT_DC-SIGN_like 139..264 CDD:153060 31/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.