DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and zmp:0000000937

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_021327947.1 Gene:zmp:0000000937 / 101884588 ZFINID:ZDB-GENE-130530-940 Length:290 Species:Danio rerio


Alignment Length:282 Identity:63/282 - (22%)
Similarity:100/282 - (35%) Gaps:86/282 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CLSSSYSAACEGVESDSQCAAYCYGVLNPCIASM------------GNLQRRVEACEAAVAIARI 65
            ||.|  ||:..|.:..|:.|..|..:|  |:..:            .|.....|..:....||.|
Zfish    26 CLPS--SASDSGKKRSSRAAPVCLVLL--CLLLLTAVIVLSVFIYTNNTNFAEERRQLITNIANI 86

  Fly    66 A---------------LNDRRLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEEN--------E 107
            .               :.|:.|.|.   |||:.:......::.|...|....|::|        :
Zfish    87 TEDRDKLLTDIINLTKIKDKVLINI---TNLEEDRDELLNKITTFTKARNEILKKNANLLKDKDQ 148

  Fly   108 IFQQL---------GSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRY 163
            :.:||         .|.:||:..|.| :|.::...|...|..|..:.:::|.| |..::...|.:
Zfish   149 LIKQLQVFGQEAYYQSSFYYLSSERK-SWTESRRDCKDRGADLIIINNKQEQD-FIMKITSNNEF 211

  Fly   164 WIDVTNQFNESEFVSVTKGSKANFLSWADG----EPTKDGECVDIRTFNGKTTMN---------- 214
            ||.:|:...|..:..| .||......||..    ||            ||:.|.|          
Zfish   212 WIGLTDSDKEGIWKWV-DGSNLTSRFWASSGSITEP------------NGRKTENCAVTHLKKHP 263

  Fly   215 ------DNSCFANLYFICEKSI 230
                  |.:|.....:||||:|
Zfish   264 ELIGWLDVACDGAYQWICEKNI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/131 (24%)
zmp:0000000937XP_021327947.1 CLECT_DC-SIGN_like 161..283 CDD:153060 32/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.