DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and LOC101884526

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_009303560.1 Gene:LOC101884526 / 101884526 -ID:- Length:269 Species:Danio rerio


Alignment Length:237 Identity:52/237 - (21%)
Similarity:87/237 - (36%) Gaps:51/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PLCLSSSYSAACEGVESDSQCAAYCYGVLNPCIASMGNLQRRVEA--------CEAAVAIARIAL 67
            |:||                 ...|..:|...|....||...:|.        ......:.:|..
Zfish    63 PVCL-----------------VLMCVAMLTVVIVMAVNLYTMIEEFYVKNTNHTNEIKTLKQIKE 110

  Fly    68 NDRRLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEE--NEIFQQLG-----SKYYYIEKEEKL 125
            |.:|:......:|..|:.:|..         :.:|:||  .:|.:..|     |..|:|..|:| 
Zfish   111 NLQRVIKNLAESNKALKEENPK---------IHQKVEELRKQINKMDGWRCNQSSLYFISSEKK- 165

  Fly   126 NWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSW 190
            ||.::...|.:.|..|..::|:||.:....::...:..||.:|:...|..:..| .|:..:...|
Zfish   166 NWTESRRDCKERGADLIIIESKEEQEFVEREIGVSDSVWIGLTDSELEGTWTWV-NGTSLSPGFW 229

  Fly   191 ADGEP----TKDGECVDIRTFNGKTTMNDNSCFANLYFICEK 228
            ..|||    |.|.:|    ..|......|..|.....:|||:
Zfish   230 GAGEPSGTSTNDEDC----AVNLPLGFGDYPCKNTFKWICER 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/115 (26%)
LOC101884526XP_009303560.1 CLECT_DC-SIGN_like 148..267 CDD:153060 32/124 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.