DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and LOC101882781

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_005155516.1 Gene:LOC101882781 / 101882781 -ID:- Length:278 Species:Danio rerio


Alignment Length:186 Identity:41/186 - (22%)
Similarity:73/186 - (39%) Gaps:48/186 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LNDRRLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEE--NEIFQQ----------------LG 113
            |::.|...|...|||:.|.    ::||.|...:.::.::  |:.::.                ..
Zfish   115 LSEEREQIFTNITNLKGER----ERLLNHNNDLTKERDQLRNDKWKMWPYEQDLPADKFRWICYN 175

  Fly   114 SKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVS 178
            :..|:|..|.| :|.|:...|.:....||.::|.||...|...::  ..:||.:|          
Zfish   176 NSLYFISSEMK-SWSDSRQDCQQRRADLAIIKSPEEKTFFQKVVD--RNFWIGLT---------- 227

  Fly   179 VTKGSKANFLSWADGEPTKDGECVD-----IRTFNGKTTMNDNSCFANLYFICEKS 229
                 |.:...|.||....:|...|     :....|..|   ::|.:|..:||||:
Zfish   228 -----KTDVWKWLDGTVLTNGSKTDSSNCAVVAAGGYYT---SACNSNNGWICEKT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 28/116 (24%)
LOC101882781XP_005155516.1 CLECT_NK_receptors_like 170..274 CDD:153063 28/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.