DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and LOC101735287

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_004918900.1 Gene:LOC101735287 / 101735287 -ID:- Length:234 Species:Xenopus tropicalis


Alignment Length:121 Identity:35/121 - (28%)
Similarity:50/121 - (41%) Gaps:11/121 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFV 177
            ||.||.:..|  .||.||...|..|...|..:.|::| ..|...|...:.:||.:.....:.:..
 Frog   120 GSCYYIVTTE--TNWTDAQAICKSMNSDLVIITSEKE-QNFLESLTNQSDFWIGLQRDKVDKDEW 181

  Fly   178 SVTKGSKANFLS--WADGEPTKDG---ECVDIRTFNGKTTMNDNSCFANLYFICEK 228
            ....|:..|.|.  |..|||...|   :||.:  :.|: ..||..|..:....|||
 Frog   182 RWVDGTLQNPLEGFWRSGEPFNAGGKEDCVHM--WLGE-KWNDRDCSFSEKAFCEK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/116 (27%)
LOC101735287XP_004918900.1 CLECT_DC-SIGN_like 111..234 CDD:153060 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.