DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and CLEC3A

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_005743.5 Gene:CLEC3A / 10143 HGNCID:2052 Length:197 Species:Homo sapiens


Alignment Length:167 Identity:42/167 - (25%)
Similarity:74/167 - (44%) Gaps:25/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCH 135
            :::...|..|...|.| ..|.:...||.:.:|.              |:..|...::|:|.:.|.
Human    47 QIEKLWTEVNALKEIQ-ALQTVCLRGTKVHKKC--------------YLASEGLKHFHEANEDCI 96

  Fly   136 KMGGHLASLQSQEEL----DRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPT 196
            ..||.|...::.:|:    |.....|.|:|.:|:.:.:...|.:||.| .|...:||:|...:|.
Human    97 SKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDV-NGIAISFLNWDRAQPN 160

  Fly   197 --KDGECVDI-RTFNGKTTMNDNSCFANLYFICEKSI 230
              |...||.. ::..||  .:|.:|.::..:|||.:|
Human   161 GGKRENCVLFSQSAQGK--WSDEACRSSKRYICEFTI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 32/118 (27%)
CLEC3ANP_005743.5 CLECT_tetranectin_like 68..193 CDD:153066 35/141 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I5435
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.