DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and LOC100537194

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_017211404.1 Gene:LOC100537194 / 100537194 -ID:- Length:306 Species:Danio rerio


Alignment Length:187 Identity:47/187 - (25%)
Similarity:80/187 - (42%) Gaps:29/187 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IALNDRRLDNFGTSTNLQLENQNTS--------QQLLTHGTAMG-RKLE-ENEI------FQQLG 113
            ::|...:|::...|.:|:.....||        .||..:..::. :||| ||.:      .::..
Zfish   126 LSLEKHQLEDKYNSLSLKKHQLETSVDELSAQKSQLQNNSNSLSQKKLELENRVTSLSDELKKAR 190

  Fly   114 SKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNR--YWIDVTNQFNESEF 176
            ||..:...||| :|.::...|...|..|..::|:.:    ...::.|.:  .||.:::...|...
Zfish   191 SKQGWFFTEEK-SWSESRQFCRNRGAELVIIKSEVK----QRVISSLVKEDVWIGLSDTETEGTM 250

  Fly   177 VSVTKGSKANFLSWADGEP----TKDGECVDIRTFNG-KTTMNDNSCFANLYFICEK 228
            ..| ..|..|...||.|||    ::|.:||::|...| ....||..|......||||
Zfish   251 KWV-DNSPMNQGFWARGEPNNYRSQDEDCVEVRISQGIPNNWNDLRCSDRRKGICEK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/118 (25%)
LOC100537194XP_017211404.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.