DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and layn

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_031762201.1 Gene:layn / 100497315 XenbaseID:XB-GENE-6050172 Length:374 Species:Xenopus tropicalis


Alignment Length:138 Identity:29/138 - (21%)
Similarity:61/138 - (44%) Gaps:25/138 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 YYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGL----NRYWI-------DVTNQ 170
            |:.:...::|:.:|.::|.:.||||.::.::.|.....:.:..:    ..:|:       :..|.
 Frog    50 YFHDTSRRVNFAEAQEQCKQDGGHLMTILTEAEQSFIESLIQSMRVPEGDFWLGLWRTEDETQNS 114

  Fly   171 FNESEFVSVTKGSKANFLSWADGEPTKDGE-CVDIRTFNGKTTM-----------NDNSCFANLY 223
            .:.:...:...|||..|.:|...||:...| ||.:  ::..:.:           ||:.|.....
 Frog   115 SDCNSLYNWVDGSKPTFWNWYADEPSCGSEACVVM--YHQPSALPGVGGLYRFQWNDDRCNMRNN 177

  Fly   224 FICEKSIE 231
            |||:.|:|
 Frog   178 FICKYSLE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 27/133 (20%)
laynXP_031762201.1 CLECT 34..182 CDD:413318 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.