DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and LOC100496055

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_017951541.1 Gene:LOC100496055 / 100496055 -ID:- Length:281 Species:Xenopus tropicalis


Alignment Length:213 Identity:47/213 - (22%)
Similarity:79/213 - (37%) Gaps:54/213 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EGVESDSQCAAYCYGVLNPCIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQN 87
            :||........|...|:....|.:.|::..:...:..:|:.:.||                    
 Frog   113 QGVPGPKGDKGYSDSVIETLRAKVNNMEAELRHLKLNMAMQKKAL-------------------- 157

  Fly    88 TSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDR 152
                :.:.||:...||              |:...|:..:.||...|.|..|.|||..:..|   
 Frog   158 ----VFSKGTSAAEKL--------------YVTNGEEATYEDAKATCTKAEGQLASPMNDAE--- 201

  Fly   153 FNNQLNGLNRYW-----IDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDG---ECVDIRTFNG 209
             |..::.|:..:     :.:.::.||..| ......|..|.:|..|||..|.   :||::|| ||
 Frog   202 -NKAISILSLQYNKPVVLGIDDKQNEGTF-KYLNNEKIVFSNWKPGEPNNDNGVEDCVELRT-NG 263

  Fly   210 KTTMNDNSCFANLYFICE 227
              ..||.:|.:....:||
 Frog   264 --IWNDMNCNSKRLTVCE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 34/120 (28%)
LOC100496055XP_017951541.1 Collagen 60..118 CDD:189968 2/4 (50%)
Surfac_D-trimer 129..174 CDD:286141 10/82 (12%)
CLECT 167..280 CDD:382969 36/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.