DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and LOC100494969

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_031755235.1 Gene:LOC100494969 / 100494969 -ID:- Length:312 Species:Xenopus tropicalis


Alignment Length:247 Identity:57/247 - (23%)
Similarity:99/247 - (40%) Gaps:34/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IIFLVLPLCLSSSYSAACEGVESDSQCAAYCYGVLNPCIASMGNLQRRVEACEAAVAIARIALND 69
            :|..:..:.||.|...:.:.|.:    ....|...:..:.::|: :...::.|..:.|.::   .
 Frog    79 LILALFVIILSKSIPGSSKSVNT----TELTYSWNSASVWAIGS-KNGSQSAELTLEIEKL---K 135

  Fly    70 RRLDNFGTSTNLQLENQNTSQQLLTHGTA-MGRKLEENEI----------FQQLGSKYYYIEKEE 123
            |.:.:..|.|..:..|...:.:.|....| :.:|:.|.:.          :..||...||.....
 Frog   136 REVHDISTRTETEWANITLNMEKLQDEVAELTKKMREQKTLPTSASCDNDWHLLGESCYYFSVTS 200

  Fly   124 KLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNG----LNRYWIDVTNQFNES--EFVSVTKG 182
            . :|..|...|......|..:.:..|....||.:..    |.|:||.:|:..:|.  |::..|..
 Frog   201 S-DWFKARAFCKTKESDLVVISTAFEQTAINNIIKAKGLELTRFWIGLTDMNSEGTWEWLDGTNY 264

  Fly   183 SKANFLSWADGEPTKDG---ECVDIRTFNGKTTMNDNSC-FANLYFICEKSI 230
            :.| |..|..|||...|   :|..||| ||:  .||..| :|....||||.:
 Frog   265 NTA-FKFWRAGEPNDAGGNEDCAHIRT-NGE--WNDVHCTYAECNAICEKKL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 36/121 (30%)
LOC100494969XP_031755235.1 CLECT_DC-SIGN_like 182..310 CDD:153060 38/132 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5116
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.