DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and colec11

DIOPT Version :10

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_004914539.1 Gene:colec11 / 100493760 XenbaseID:XB-GENE-952506 Length:277 Species:Xenopus tropicalis


Alignment Length:123 Identity:37/123 - (30%)
Similarity:58/123 - (47%) Gaps:9/123 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 QQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLN--GLNRYWIDVTNQFN 172
            ::..:|.|.:.|||| .:.||.|.|...||.|:..:.:.......:.:|  ||:|.:|.:.:...
 Frog   153 RETDTKIYLLVKEEK-KYIDAQDYCQGRGGTLSMPKDETTNSLIASYINQAGLSRVFIGINDLER 216

  Fly   173 ESEFVSVTKGSKANFLSWADGEPTK---DGECVDIRTFNGKTTMNDNSCFANLYFICE 227
            |..||...:.....|..|..|||..   :.:|.::.:..|   .||.||...:|||||
 Frog   217 EGHFVYSDRSPMQTFNKWRQGEPNNAYDEEDCAEMVSSGG---WNDVSCLITMYFICE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 36/117 (31%)
colec11XP_004914539.1 Collagen <40..80 CDD:460189
CLECT_collectin_like 158..272 CDD:153061 37/118 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.