DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and mrc1

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_012821081.2 Gene:mrc1 / 100493504 XenbaseID:XB-GENE-494275 Length:1450 Species:Xenopus tropicalis


Alignment Length:169 Identity:43/169 - (25%)
Similarity:77/169 - (45%) Gaps:19/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TSTNLQLENQNTSQQL--------LTHGTAMGRKLEENEI-----FQQLGSKYYYIEKEEKLNWH 128
            |..|.:.||:..:|:|        :|..|.:.....::.|     :.......|.::||.|: |.
 Frog   318 TGKNGKWENKECNQKLGYICKKGSITSSTFVMPSESDSPISCPPSWLPYAGNCYTVKKENKI-WK 381

  Fly   129 DALDKCHKMGGHLASLQSQEELDRFNNQ--LNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWA 191
            :||..|.|..|.|||..:.|||...::|  .....:.||.:.:|.:...| ..:.|:..::..|.
 Frog   382 EALSSCRKEEGDLASFHNVEELSFISSQFEFEQTTKVWIGLNDQKSHMYF-EWSDGTPVSYTVWL 445

  Fly   192 DGEPT-KDGECVDIRTFNGKT-TMNDNSCFANLYFICEK 228
            .|||: :|.:..|...|:.|: ..:|:.|.....:||::
 Frog   446 RGEPSHRDNKQEDCVAFDPKSGHWSDDMCEMKFQYICKR 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 34/115 (30%)
mrc1XP_012821081.2 RICIN 26..140 CDD:214672
FN2 159..207 CDD:128373
CLECT 227..339 CDD:153057 6/20 (30%)
CLECT 359..483 CDD:214480 33/125 (26%)
CLECT 501..623 CDD:214480
CLECT 643..775 CDD:413318
CLECT 799..920 CDD:214480
CLECT 941..1076 CDD:214480
CLECT 1095..1209 CDD:214480
CLECT 1226..1355 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.