DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and cd302

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_031749737.1 Gene:cd302 / 100489250 XenbaseID:XB-GENE-983080 Length:1838 Species:Xenopus tropicalis


Alignment Length:118 Identity:30/118 - (25%)
Similarity:52/118 - (44%) Gaps:7/118 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 YYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTK 181
            |....|..|.|.:|...|...|..|.|:.:.|||..|.::.:..:..||.: |..:.|.....:.
 Frog   224 YQFNMESILTWKEAYISCQNQGADLLSISTPEELQVFTDKEDVPDSVWIGL-NHLDTSGGWQWSD 287

  Fly   182 GSKANFLSW----ADGEPTKDGECVDIRTFNGKTTMNDNSCFANLYFICEKSI 230
            .:...|::|    |......|.:|..:.|..|:  |.:..|..:|.:||:|::
 Frog   288 HTPLRFINWDKDRASFSLLDDKDCAILNTDTGR--MENIHCEKSLPYICKKNL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 29/114 (25%)
cd302XP_031749737.1 RICIN 31..138 CDD:214672
FN2 156..203 CDD:128373
CLECT 210..335 CDD:214480 28/113 (25%)
CLECT 354..476 CDD:214480
CLECT 493..612 CDD:214480
CLECT 630..771 CDD:214480
CLECT 803..912 CDD:153057
CLECT 933..1074 CDD:214480
CLECT 1099..1200 CDD:153057
CLECT 1232..1347 CDD:214480
CLECT 1390..1499 CDD:153057
CLECT 1628..1760 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.