DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and clec3a

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_002935100.1 Gene:clec3a / 100486528 XenbaseID:XB-GENE-986191 Length:193 Species:Xenopus tropicalis


Alignment Length:165 Identity:40/165 - (24%)
Similarity:63/165 - (38%) Gaps:28/165 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RLDNFGTSTNLQLENQNTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCH 135
            ::|......| .|:.....|.:...||.:.:|.              |:..||..::|:|.:.|.
 Frog    45 QIDKLWREVN-SLKEMQALQTVCLRGTKIHKKC--------------YLSFEETKHFHEANEDCI 94

  Fly   136 KMGGHLASLQSQEE----LDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKANFLSWADGEPT 196
            ..||.||..:..||    .|.....|.|...:|:.:.:..||.:||.| .|....:.:|.  .|.
 Frog    95 AKGGTLAIPRDAEENNALRDYGKKSLRGSGEFWLGINDMVNEGKFVDV-NGVAITYFNWE--RPP 156

  Fly   197 KDGECVDIRTFN----GKTTMNDNSCFANLYFICE 227
            ..|:..:....|    ||..  |..|.:...:|||
 Frog   157 NGGKRKNCALLNQASQGKWV--DEVCRSLKKYICE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/120 (28%)
clec3aXP_002935100.1 CLECT_tetranectin_like 66..190 CDD:153066 36/143 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.