DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and bcan

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_004917413.2 Gene:bcan / 100486298 XenbaseID:XB-GENE-5829331 Length:1150 Species:Xenopus tropicalis


Alignment Length:257 Identity:57/257 - (22%)
Similarity:94/257 - (36%) Gaps:68/257 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GVLNPCIASMGNLQRRVEACEAAVAI------ARIALNDRRLDNFGTST----------NLQLEN 85
            |:.:..:.:|........:.||..|.      .|..|:....||...||          |:.:..
 Frog   834 GLSSTALPNMEESSEEPSSGEATTASPVHYVPLRYTLSPPPTDNSEDSTTHIQEKTAHPNVSMST 898

  Fly    86 QNTSQQLLTHGTAMGRKL-------------------EENEIFQQLGSKYY-------YIEK--- 121
            .|....:.|....:|..:                   ||:|.|:.|....|       .:||   
 Frog   899 TNPPPAIPTERAILGASINLSDVCYPNPCGNGGTCIDEEDEDFRCLCLPGYTGKICEINVEKCLG 963

  Fly   122 -------------EEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNE 173
                         .|:.:|.:|...|...||||.|:.:.||.:..||:.|  :..|..:.::..|
 Frog   964 DWDSFQGFCYRHFHERRSWEEAETFCRDAGGHLTSIMTPEEQEFLNNKYN--DYQWTGLNDRTIE 1026

  Fly   174 SEFVSVTKGSKANFLSWADGEPTK---DGE-CVDIRTFN-GKTTMNDNSCFANLYFICEKSI 230
            .:| ..:.|:...:.:||.|:|..   .|| ||.:...| ||  .:|..|..:|.|:|:..:
 Frog  1027 GDF-QWSDGNPLLYENWAHGQPDSYFLSGENCVVMVGHNEGK--WSDVPCNYHLPFVCKMGL 1085

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 37/139 (27%)
bcanXP_004917413.2 Ig 44..163 CDD:416386
Ig strand A' 45..47 CDD:409353
Ig strand B 51..61 CDD:409353
Ig strand C 80..86 CDD:409353
Ig strand C' 91..94 CDD:409353
Ig strand D 112..117 CDD:409353
Ig strand E 123..129 CDD:409353
Ig strand F 137..144 CDD:409353
Ig strand G 154..163 CDD:409353
Link_domain_CSPGs_modules_1_3 161..255 CDD:239594
Link_domain_CSPGs_modules_2_4 262..357 CDD:239597
termin_org_DnaJ <369..>726 CDD:274808
EGF_CA 924..955 CDD:238011 6/30 (20%)
CLECT_CSPGs 961..1084 CDD:153058 34/127 (27%)
CCP 1088..1145 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.