DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and colec12

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_002934169.1 Gene:colec12 / 100379961 XenbaseID:XB-GENE-984626 Length:748 Species:Xenopus tropicalis


Alignment Length:169 Identity:46/169 - (27%)
Similarity:76/169 - (44%) Gaps:25/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NFGTSTNLQLENQNTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMG 138
            :.|:|..|   :|..|.:::......|..||    ::....|.||....:.: :.||...|.:.|
 Frog   588 DLGSSLAL---HQAPSAEVMLEPVVTGCPLE----WKNFSDKCYYFSTGKDI-FDDAKLICEEKG 644

  Fly   139 GHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTK---GSKANFLSWADGEP----- 195
            ..|..:::|.|......|.:|...:||.:|    ::|..||.|   |:..|:.:|.:|:|     
 Frog   645 AMLVVIETQAEQQFLKKQTSGKGNFWIGLT----DAEEESVWKWLDGTIPNYKNWKEGQPDNWSH 705

  Fly   196 -TKDGE-CVDIRTFNGKTTMNDNSCFANLYFICEKSIEI 232
             |..|| |..: .::|  ..||..|.....|||||.|::
 Frog   706 QTGPGEDCAGL-IYSG--LWNDFHCQDYNNFICEKPIDL 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 34/121 (28%)
colec12XP_002934169.1 CCDC158 <79..>402 CDD:318193
CLECT_DC-SIGN_like 612..737 CDD:153060 37/136 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.