DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and LOC100363064

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038945816.1 Gene:LOC100363064 / 100363064 RGDID:2324825 Length:285 Species:Rattus norvegicus


Alignment Length:196 Identity:53/196 - (27%)
Similarity:80/196 - (40%) Gaps:39/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VAIARIALN--DRRLDNFGTS-----------TNLQLENQNTSQQLLTHGTAMGRKLE------- 104
            |.::||..|  .:..|..|:|           |:..||.....||:....|.....|.       
  Rat    88 VQVSRICANPQGQTQDQKGSSSLGKVAVPQEQTHTGLEQIQQIQQIQQQLTQFNASLAGLCRPCP 152

  Fly   105 -ENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRF----NNQLNGLNRYW 164
             :.|.||  ||.|.:  .....:|..:...|..:|.||..:.|..| .||    |.:.|  .|.|
  Rat   153 WDWEFFQ--GSCYLF--SRTLASWGASASSCKDLGAHLVIINSVAE-QRFMKYWNVRKN--QRSW 210

  Fly   165 IDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDG--ECVDIRTFNGKTTMNDNSCFANLYFICE 227
            |.:::...|..:..|.. |...|..|.:|||..||  :||::  |..:  .|||:|....:::||
  Rat   211 IGLSDHLREGSWQWVDH-SPLKFSFWKEGEPNNDGDEDCVEL--FMDE--WNDNTCTQQNFWVCE 270

  Fly   228 K 228
            :
  Rat   271 Q 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 33/117 (28%)
LOC100363064XP_038945816.1 CLECT_DC-SIGN_like 151..270 CDD:153060 37/130 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.