Sequence 1: | NP_001356891.1 | Gene: | CG7763 / 36235 | FlyBaseID: | FBgn0040503 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038945816.1 | Gene: | LOC100363064 / 100363064 | RGDID: | 2324825 | Length: | 285 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 53/196 - (27%) |
---|---|---|---|
Similarity: | 80/196 - (40%) | Gaps: | 39/196 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 VAIARIALN--DRRLDNFGTS-----------TNLQLENQNTSQQLLTHGTAMGRKLE------- 104
Fly 105 -ENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRF----NNQLNGLNRYW 164
Fly 165 IDVTNQFNESEFVSVTKGSKANFLSWADGEPTKDG--ECVDIRTFNGKTTMNDNSCFANLYFICE 227
Fly 228 K 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7763 | NP_001356891.1 | CLECT | 116..228 | CDD:153057 | 33/117 (28%) |
LOC100363064 | XP_038945816.1 | CLECT_DC-SIGN_like | 151..270 | CDD:153060 | 37/130 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |