DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and cd209

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001186302.2 Gene:cd209 / 100334918 ZFINID:ZDB-GENE-061207-22 Length:343 Species:Danio rerio


Alignment Length:176 Identity:47/176 - (26%)
Similarity:74/176 - (42%) Gaps:22/176 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ALNDRRLDNFGTSTNLQLENQ----------NTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIE 120
            |:.| :|:|.  ..||..||:          ..|.||......:.::|.|.:.:....|.:|:|.
Zfish   173 AMKD-QLENI--IKNLLKENKQFSSKNEDLLKQSAQLKKEKKDLEKRLHEQDSWFYFQSSFYFIS 234

  Fly   121 KEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQLNGLNRYWIDVTNQFNESEFVSVTKGSKA 185
            .||: ||.::...|...|..|..:.::||.|.......|.. .||.:|:..:..:::..| ....
Zfish   235 SEER-NWTESRRYCRDKGADLIIINNREEQDHVKKMSGGFT-VWIGLTDSDDRWKWIDGT-NMTT 296

  Fly   186 NFLSWADGEPTKDG--ECVDIRTFNGKTTMNDNSCFANLYFICEKS 229
            .|..|..|||...|  .||..|:    :...|..||....:||||:
Zfish   297 GFRFWNHGEPNGQGGENCVTSRS----SGWADYPCFYPFPWICEKN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 31/113 (27%)
cd209NP_001186302.2 DivIC 94..183 CDD:299713 4/12 (33%)
CLECT_DC-SIGN_like 220..337 CDD:153060 32/123 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.