DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and si:ch211-193e13.5

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_009303416.1 Gene:si:ch211-193e13.5 / 100331104 ZFINID:ZDB-GENE-081104-158 Length:257 Species:Danio rerio


Alignment Length:225 Identity:53/225 - (23%)
Similarity:87/225 - (38%) Gaps:53/225 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CAAYCYGVLNPCIASMGNLQRR----------VEACEAAVAIARIALNDRRLDNFGTSTNLQLEN 85
            ||.....|:..|:..:  :||:          .|..|....|.:  ||:.|.:.....|||..|.
Zfish    56 CALLLTAVIVLCVFFI--IQRKHLLTHISKLIEEQEEILTNITK--LNEEREETITNITNLIEER 116

  Fly    86 QNTSQQL--LTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQE 148
            |....::  |..|.....:|.:|..:......:|||..|:| :|.|:...|.:....||.::|.|
Zfish   117 QQIKNKIDELQLGFYEQDQLSDNFKWIYYNFSFYYISSEKK-SWEDSRRDCQQRNADLAIIKSPE 180

  Fly   149 ELDRFNNQLNGLNRYWIDVT----NQFNESEFVSVTKGSKANFLSWADGEPTKDG--------EC 201
            | .:...::...:.|||.:|    .|:|                 |.||....|.        .|
Zfish   181 E-KKCLLKVAASDFYWIGLTKKHYRQWN-----------------WVDGSLLTDWYFNRHSHYYC 227

  Fly   202 VDIRTFNGKTTMNDNSCFANL-YFICEKSI 230
            ..|.:...:    :.|| ||| .:||::::
Zfish   228 AMITSAGWR----EKSC-ANLNKWICKRTV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 32/124 (26%)
si:ch211-193e13.5XP_009303416.1 DASH_Dad1 69..>106 CDD:285812 8/40 (20%)
CLECT_NK_receptors_like 141..250 CDD:153063 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.