DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and dcsignlg

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_002660626.3 Gene:dcsignlg / 100320246 ZFINID:ZDB-GENE-090313-154 Length:263 Species:Danio rerio


Alignment Length:190 Identity:48/190 - (25%)
Similarity:76/190 - (40%) Gaps:50/190 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 DNFGTSTN-LQLENQNTS-----QQLLT--HGTAMGRKLEENEI------FQQLGSKY-YYIEKE 122
            ||....|: .|||::..|     |||.|  :..::|::..||.:      .::..||. ::....
Zfish    90 DNTDLETDKQQLEDKYNSLSLKKQQLETKYNSLSLGKQQLENRVTSLSAELKEARSKSGWFFMST 154

  Fly   123 EKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQL-------------NGLNRY-WIDVTNQFNE 173
            |.::|.::...|...|..|..::| ||..||.:.|             .|.|:: |:|       
Zfish   155 EAMSWSESRQFCRDRGADLVIIKS-EEKQRFISSLVKEDTWIGLSVTETGGNKWKWVD------- 211

  Fly   174 SEFVSVTKGSKANFLSWADGEPTK----DGECVDIRTFNG-KTTMNDNSCFANLYFICEK 228
                    .|..|...||.|||..    ..:||::|...| ....||..|..:...:|||
Zfish   212 --------NSPLNQGFWAKGEPNNYQGAKEDCVEVRISQGTPNNWNDRRCSDSRKAVCEK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 30/131 (23%)
dcsignlgXP_002660626.3 IncA <40..>144 CDD:282066 14/53 (26%)
Uso1_p115_C 78..>146 CDD:282695 14/55 (25%)
CLECT_DC-SIGN_like 144..263 CDD:153060 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.