DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and cd93

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_002936962.2 Gene:cd93 / 100145420 XenbaseID:XB-GENE-978135 Length:584 Species:Xenopus tropicalis


Alignment Length:115 Identity:32/115 - (27%)
Similarity:51/115 - (44%) Gaps:22/115 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 THGTAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDRFNNQL- 157
            |||   |....:||:.  ..||..|....||.::.||.:||...||:|.:::||||.:...:.| 
 Frog    18 THG---GHASVQNEVL--CVSKACYTVDLEKNSFADAANKCDTNGGNLVTIKSQEEAEYVTSLLS 77

  Fly   158 --------NGLNRYWIDVTNQFNE-SEFVSVTKGSKANFLSWADGEPTKD 198
                    :|..:.||.:  :.|. ::.....||     .:|..|:...|
 Frog    78 KLTSDTPHHGALKLWIGL--KLNSCTDRRKTLKG-----FAWVTGQEDTD 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 24/93 (26%)
cd93XP_002936962.2 CLECT_thrombomodulin_like 31..171 CDD:153070 26/97 (27%)
FXa_inhibition 256..293 CDD:373209
cEGF 314..337 CDD:372248
EGF_CA 334..370 CDD:214542
EGF_CA 371..399 CDD:238011
cEGF 390..413 CDD:372248
FXa_inhibition 419..447 CDD:373209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.