DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and hbl4

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001108197.1 Gene:hbl4 / 100137128 ZFINID:ZDB-GENE-070912-287 Length:245 Species:Danio rerio


Alignment Length:153 Identity:32/153 - (20%)
Similarity:62/153 - (40%) Gaps:13/153 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TNLQLENQNTSQQLLTHGTAMGRKLEENEIFQQLGSKYYYIEKEEKL--NWHDALDKCHKMGGHL 141
            |.|:.:.::.:.:|......:|.::     |:::|.|||.   .:.|  |:..|...|...|..:
Zfish   101 TQLRSDVKHLTDRLTVIDKVLGFRM-----FKKVGQKYYV---SDGLVGNFETAQKFCSDAGAKI 157

  Fly   142 ASLQSQEELDRFNNQLNGLNRYWIDV--TNQFNESEFVSVTKGSKANFLSWADGEPTKDGECVDI 204
            ...:|::|.....:....|...::.|  |:...|..||.:: .....|.:|.:.||.......|.
Zfish   158 VLPRSEDENKVLISLQEALESTYVHVGATDAKKEGHFVDLS-DQPLTFTNWKEKEPNDYNGAEDC 221

  Fly   205 RTFNGKTTMNDNSCFANLYFICE 227
            .........||.:|.:..:.:||
Zfish   222 TAVYKTGVWNDINCNSKWHVVCE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 25/116 (22%)
hbl4NP_001108197.1 Collagen 33..>92 CDD:189968
CLECT_collectin_like 131..245 CDD:153061 26/118 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.