DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7763 and si:ch211-214k5.3

DIOPT Version :9

Sequence 1:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_009303575.2 Gene:si:ch211-214k5.3 / 100034611 ZFINID:ZDB-GENE-041210-206 Length:291 Species:Danio rerio


Alignment Length:214 Identity:56/214 - (26%)
Similarity:81/214 - (37%) Gaps:73/214 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TSTNLQLENQNTS-------------------QQLLTH---GTAMGRKL--EENEI--------- 108
            |.||...||:.||                   .|||.:   |.|..:.|  |:||:         
Zfish    86 THTNYTQENRITSLTEERDQLLINITNLIEERDQLLININAGNAQNQNLTKEKNELLSKNDDLII 150

  Fly   109 ----FQQL-----------------GSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDR 152
                .||:                 .|.:|:|..|:| ||.::...|...|..|..:.::||.| 
Zfish   151 QNVQLQQVENNLQECRNKLDGWFNYQSSFYFISSEKK-NWSESTRNCRDRGADLIIINNKEEQD- 213

  Fly   153 FNNQLNGLNRYWIDVTNQFNESEF-----VSVTKGSKANFLSWADGEPT-KDGECVDIRTFNGKT 211
            |..:::|.:..||.:::...|..:     .|:|.|    |..|...||. |.||...:...:|  
Zfish   214 FVKKISGGDVVWIGLSDSDEEGSWKWVDDPSMTSG----FRFWGTFEPNGKRGENCAVSRSSG-- 272

  Fly   212 TMNDNSCFANLYF--ICEK 228
             ..|..|  |.||  ||||
Zfish   273 -WADYPC--NNYFQWICEK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 35/119 (29%)
si:ch211-214k5.3XP_009303575.2 ATPgrasp_Ter 113..>187 CDD:330691 15/73 (21%)
CLECT_DC-SIGN_like 170..288 CDD:153060 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.