DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-3 and smyd3

DIOPT Version :9

Sequence 1:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001032477.1 Gene:smyd3 / 569507 ZFINID:ZDB-GENE-051120-138 Length:380 Species:Danio rerio


Alignment Length:355 Identity:77/355 - (21%)
Similarity:119/355 - (33%) Gaps:130/355 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 EGRFARASADVKPGEELLVERPFVSVLLEKFAKTHCENCFMRTVVPVACPRCADVLYCSEQCREE 313
            :|...||..::||||.:....||...:...|.||.|::|..|......|.:|....||:.||:::
Zfish    14 KGNGLRALREIKPGEVIYSCEPFAFCVARDFLKTACQSCLKRGESLSRCSQCKTARYCNVQCQKQ 78

  Fly   314 ASKKYHKYECGIVPIIWRSGASINNHIALRIIASKPLDYFLKLKPTIDEELTPE---QLISLPKD 375
            |... ||.||..:           .|:..||             ||....|...   :|:|..:.
Zfish    79 AWPD-HKRECKCL-----------KHLQPRI-------------PTDSVRLVARIIFKLLSQSES 118

  Fly   376 DFRRVAQLERHQG-------------------------------ERQPSNFFQHVLMARFLTNCL 409
            |...:..:..||.                               .|.||......|:||...|| 
Zfish   119 DQEELYSIAEHQSHLADMSEEKTEGLKHLCTTLQVYLAEENCDLSRLPSGLDPVSLLARVTCNC- 182

  Fly   410 RAGGYFGSEPKPDEVSIICSLVLRSLQFIQFNTHEVAELHKFS-SSGREKSIFIGGAIYPTLALF 473
                                                     || |.|..:.:.:|  :||:::|.
Zfish   183 -----------------------------------------FSISDGELQDVGVG--LYPSMSLL 204

  Fly   474 NHSCDPGVVRYFRGTTIHINSVRPIEAGLPINENYGPMY--TQDERS--------ERQARL---- 524
            ||.|.|..:..|.|..:.:.:||.|.:...:..:|..:.  ::|.||        |.||.|    
Zfish   205 NHDCQPNCIMMFEGKRLTLRAVRVIRSAEELTISYTDILAPSKDRRSQHWDELLKESQALLHRHS 269

  Fly   525 -----KDLYW---FECSCDACIDNWPKFDD 546
                 :::|.   .:.:.||||    ..||
Zfish   270 DVVPDRNIYMLRLLDLAMDACI----SLDD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 12/38 (32%)
smyd3NP_001032477.1 zf-MYND 49..87 CDD:280009 12/38 (32%)
SET <201..239 CDD:279228 10/37 (27%)
TPR_12 276..351 CDD:290160 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9821
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X437
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.