DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-3 and Smyd3

DIOPT Version :9

Sequence 1:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster


Alignment Length:462 Identity:102/462 - (22%)
Similarity:171/462 - (37%) Gaps:138/462 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 IDSNRQEGRFARASA-------------DVKPGEELLVERPFVSVLLEKFAKTHCENCFMRTVVP 294
            :.|:|.....|.|||             .:|.|:.:|.|:||..||..::....|:||...|.| 
  Fly     6 VGSSRSATTSATASACSSKSKNLKNPAPQIKRGQRILTEKPFAFVLKSQYRLERCDNCLEATKV- 69

  Fly   295 VACPRCADVLYCSEQCREEASKKYHKYECGIVPIIWRSGASINNHIALRIIASKPLDYFLKLKPT 359
            :.|..|..|.||...|:.:|..: ||:||.                            |||   .
  Fly    70 LKCSNCRYVSYCHRSCQMQAWGQ-HKHECP----------------------------FLK---K 102

  Fly   360 IDEELTPEQLISLPKDDFRRVAQLERHQGERQPSNFFQH------VLMARFLTNCLRAGGYFGSE 418
            :...:.|:....|    .|.:.:|| |.|:.....:.:|      .||:.:            :|
  Fly   103 VHPRVVPDAARML----CRLILRLE-HGGDLIRGYYTEHGSRKFRDLMSHY------------AE 150

  Fly   419 PKPDEV---------SIICSLVLRSLQFIQFNTHEVAELHKFSSSG----REKSIFIGGAIYPTL 470
            .|.|.:         :::..::..|...:...|..::...:..::|    ..:...|..|||..:
  Fly   151 IKNDPMRLEHLDSLHAVLTDMMAESPSTVPNKTELMSIYGRLITNGFNILDAEMNSIATAIYLGV 215

  Fly   471 ALFNHSCDPGVVRYFRGTTIHINSVRPIEA--GLPINENYGPMYTQDERSERQARLKDLYWFECS 533
            ::.:|||.|..|..|.|..:|::::..:|.  ...|..:|..:....|  :|:..||:.|:|.|.
  Fly   216 SITDHSCQPNAVATFEGNELHVHAIEDMECLDWSKIFISYIDLLNTPE--QRRLDLKEHYYFLCV 278

  Fly   534 CDACIDNWPKFDDLPRDVIRFRCDAPN-NCSAVIEVPPSCNDFMVKCVTCG-----EITNILKGL 592
            |..|.|....     ::::...|  || ||.|.|.|..:      .|..|.     ::.|..   
  Fly   279 CSKCTDAKES-----KEMLAALC--PNRNCGAGISVDRN------NCPRCDAGISPKLRNAF--- 327

  Fly   593 KVMQDTEMMTRTAKRLYETGEYPKALAKFVDLIRIMYE----VLAPPFPDFCESQQHLKDCFLNL 653
                 .|.||.|...|    |..|.:| ::|:.::..:    |..|                ||:
  Fly   328 -----NEAMTLTRHNL----ENMKDVA-YLDVCKVCLDKQTGVFHP----------------LNV 366

  Fly   654 GNVYTLD 660
            ..|.|||
  Fly   367 WYVKTLD 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 14/38 (37%)
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 14/38 (37%)
TPR_12 377..440 CDD:290160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X437
32.810

Return to query results.
Submit another query.