DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-3 and SmydA-5

DIOPT Version :9

Sequence 1:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster


Alignment Length:455 Identity:86/455 - (18%)
Similarity:156/455 - (34%) Gaps:125/455 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 AMTMIKMLQN-DPRTAKQEAKQQKQKIALDQAKPVKLENEFVSPLVRIDSNRQEGRFARASADVK 260
            |.|..||::. |....||...|.|::     .:|...|.:           .:.||:.:.:.::.
  Fly    17 ACTRCKMVRYCDREHQKQHWPQHKRR-----CRPFSEEQD-----------AELGRYLKVTQNIA 65

  Fly   261 PGEELLVERP-------FVSVLLEKFAKTHCENCFMRTVVPV-----ACPRCADVLYCSEQCREE 313
            .|:.:.:|.|       ::|...::.:...|..|:    .|.     .|.||...: ||..|:.|
  Fly    66 AGQIVFIEEPLVVGPKWYLSDADKEASNVPCVGCY----TPCRLGKHQCRRCRWPV-CSAGCKHE 125

  Fly   314 ASKKYHKYECGIVPIIWRSGASINNHIALRIIASKPLDYF-----LKLKPTIDEELTPEQLISLP 373
            :      .||.::        |:.:....|..|....|||     |.||..:.:..:|.:..:| 
  Fly   126 S------MECSVL--------SLGSGSPTRADARSLNDYFRGDALLVLKCLLLQRQSPTKWSAL- 175

  Fly   374 KDDFRRVAQLERHQGERQPSNFFQHV-------LMARFLTNCLRAGGYFGSEPKPDEVSIICSLV 431
                   .:::.|:.||:.::.::..       |..|||....:......::..|:.:..:|.::
  Fly   176 -------LEMQSHEEERKGTDLYEEAEKRVVTYLQKRFLCRLKQTNPNLLTDCGPEMLHRLCGII 233

  Fly   432 LRSLQFIQFNTHEVAELHKFSSSGREKSIFIGGAIYPTLALFNHSCDPGVVRYFRGTTIHINSVR 496
            ..:...|:.            .||.|.|     .::....:..|:|.|.....|...|..:    
  Fly   234 ETNFMVIEL------------PSGVELS-----GLFRQACMMEHACQPNCDFQFDNKTQQV---- 277

  Fly   497 PIEAGLPINEN-----------YGPMYTQDERSERQARLKDLYWFECSCDACIDNWPKFDDLPRD 550
            .:.||..:.:.           :|...       ||..|:....|.|.|..|:|        |.:
  Fly   278 AVRAGCDLRKGDHLRITYTNILWGTQL-------RQHHLRLTKHFSCRCSRCLD--------PTE 327

  Fly   551 ----VIRFRC--DAPNNCSAV-IEVPPSCNDFMVKCVTCGEITNILKGLKVMQDTEMMTRTAKRL 608
                :....|  |....|... :.|.|...:...||.||   ..|:.|..|.:....||...:.|
  Fly   328 YGTYISALTCLGDVNQTCGGTHLPVDPLDENTQWKCDTC---PMIVDGAYVAELQSHMTEQVEGL 389

  Fly   609  608
              Fly   390  389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 10/43 (23%)
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009 9/30 (30%)
SET 185..295 CDD:279228 19/130 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.