DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-3 and SmydA-3

DIOPT Version :9

Sequence 1:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001260366.1 Gene:SmydA-3 / 34502 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster


Alignment Length:419 Identity:92/419 - (21%)
Similarity:154/419 - (36%) Gaps:108/419 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 GRFARASADVKPGEELLVER-PFVSVLLEKFAKTHCENCFMRTVVPVACPRC------ADVLYCS 307
            ||:..|...:: |..||:|. ||.       ....|..       ||.|..|      .:...||
  Fly    21 GRYLVAKGAIR-GHGLLIEELPFA-------VGPKCNG-------PVVCLGCYEPNPDPEEELCS 70

  Fly   308 E-------QCREEASKKYHKYECG----------IVPIIWRSGASINNHIALRIIASKPLDYFLK 355
            |       :|.::|...:.:.||.          .:|    ||   :.|       ...||..:.
  Fly    71 ECGWPLCVECAQQADNAHFRLECSQLKDARARFFRLP----SG---SRH-------CPQLDCIMP 121

  Fly   356 LKPTIDEELTPEQLISLPKDDFRRVAQLERHQGERQPSNFFQH---VLMARFLTNCLRAGGYFGS 417
            |:..:.:|..||:..:       .||.:|.|:.|||......|   |.:|::|....:....|..
  Fly   122 LRVLLAKEANPERWDN-------EVAPMEHHKEERQRDADVWHADRVNIAQYLRGPCQLANRFSE 179

  Fly   418 EPKPDEVSIICSLVLRSLQFIQFNTHEVAELHKFSSSGREKSIFIGGAIYPTLALFNHSCDPGVV 482
            |           |:::.:..::.|..|          .|....:....::|...:..|:|.|...
  Fly   180 E-----------LIMQVVGVLEVNAFE----------ARSPKGYPLRCLFPYTGILAHNCVPNTS 223

  Fly   483 RYF---RGTTIHINSVRPIEAGLPINENYGPMYTQDERSERQARLKDLYWFECSCDACIDNWPKF 544
            |..   .|..|.:.::..:|.|.|::.:|  .||.|..::||..||...:|.|.|:.|:|.    
  Fly   224 RSIYPSEGYKIRLRAMVDLEEGQPLHHSY--TYTLDGTAQRQKHLKQGKFFTCQCERCLDP---- 282

  Fly   545 DDLPRDVIRFRCDAPNNCSAVIEVP--PSCNDFMVKCVTCGEITNILKGLKVMQD-------TEM 600
            .:|.......:|   ..|:...:||  |:..|....|..||..|:....|.::|.       .:.
  Fly   283 TELGTHFSSLKC---GQCAEGFQVPRQPTEPDTSWNCANCGSDTSNADALAMLQSLQSEVNAVQA 344

  Fly   601 MTRTAKRLYETGEYPKALAKFVDLIRIMY 629
            :...||||   .|..:.|.|:..|:..::
  Fly   345 LPMAAKRL---EEIERLLRKYKSLLHPLH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 10/51 (20%)
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 10/44 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.