DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-3 and SmydA-9

DIOPT Version :9

Sequence 1:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001285040.1 Gene:SmydA-9 / 31859 FlyBaseID:FBgn0030102 Length:500 Species:Drosophila melanogaster


Alignment Length:360 Identity:75/360 - (20%)
Similarity:121/360 - (33%) Gaps:77/360 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 PLVRIDSNRQEGRFARASADVKPGEELLVERPFVSVLL--EKFAKTHCENCF-MRTVVPVACPRC 300
            |...|..::..||...|:..:|.||.:..:.|.:..|.  |:.:...|..|. |.......|.:.
  Fly    23 PAWEIGVSKIAGRGVVATRSLKRGEIIFRDSPLLIGLAAHEEDSLNACSVCLKMLPDTRFMCRQG 87

  Fly   301 ADVLYCSEQCREEASKKYHKYECGIVPIIWRSGASINNHIALRIIASKPLDYFLKLKPTIDEELT 365
            ..:..|| .|   |.||.||.:|.:......:...:.|.:.:|:                   |.
  Fly    88 CGLPVCS-LC---AKKKQHKSDCDLFKSWGPNEPDVANSVIIRL-------------------LC 129

  Fly   366 PEQLISLPKDDFRRVAQLERHQGERQPSNFFQHVLMARFLTNCLRAGGYFGSEPKPDEVSIICSL 430
            ..:.|:|.|:....:..|:.:...       .|....|....|.:   .|.::.|..|:......
  Fly   130 VARAINLSKEQRDLIYCLQANLDN-------NHRTEVRNAAKCFK---NFPTDKKLIEIMNRTVA 184

  Fly   431 VLRSLQFIQFNTHEVAELHKFSSSGREKSIFIGGAIYPTLALFNHSCDPGVVRYFRGTT--IHIN 493
            |||:..|           .|.:....:...|...|:||...:.||.|.|.....|...|  :.:.
  Fly   185 VLRTNGF-----------DKTTDRTNDNQEFNYRALYPLFGVVNHDCIPNAYYTFEEKTNNMIVR 238

  Fly   494 SVRPIEAGLPINENYGPMYTQDERSERQARLKDLYWFECSCDACIDNWPKFDDLP----RDVIRF 554
            :...|..|..:...|..::|.:  ..|...||....|.|.|..|.|...|...:.    ||    
  Fly   239 AAVDIPEGFEVTTTYTKLFTGN--IARHLFLKMKKSFTCKCSRCSDPTEKGAFISGLYCRD---- 297

  Fly   555 RCDAPNNCSAVIEVP-------PSCNDFMVKCVTC 582
                 .||:.:: ||       |:.|     |:.|
  Fly   298 -----TNCTGLV-VPEITGLPHPNWN-----CLVC 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 12/39 (31%)
SmydA-9NP_001285040.1 SET 25..>66 CDD:295368 10/40 (25%)
SET <216..253 CDD:279228 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.