DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-3 and Smyd5

DIOPT Version :9

Sequence 1:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001101340.1 Gene:Smyd5 / 312503 RGDID:1309153 Length:417 Species:Rattus norvegicus


Alignment Length:388 Identity:94/388 - (24%)
Similarity:150/388 - (38%) Gaps:109/388 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LENEFVSPLVRIDSNRQEGRFARASADVKPGEELLVERPFV------SVLLEKFAKTHC------ 284
            :|..|||      |.:.:|.|  |:..::.||.:.:|||.|      :.|....|..||      
  Rat    23 VEVRFVS------SAKGKGLF--ATQLIRKGETIFIERPLVASQFLWNALYRYRACDHCLRALEK 79

  Fly   285 -------------------ENCFMRTVVPVACPRCADVLYCSEQCREEASKKYHKYEC------- 323
                               |.|.:|..:...|||| .|.|||.:||..|:::||:..|       
  Rat    80 AEENAQRLTGKPGQVLPHPELCSVRKDLHQNCPRC-QVTYCSAECRLAAAEQYHQILCPGPSQDD 143

  Fly   324 -----GIVPIIWRS------GASINNHIALRIIA----SKPLDYFLKL-----KPTIDEELTPEQ 368
                 ..:...|||      .|||  .:..|::|    :|..|::::|     ..|.:||   |:
  Rat   144 PRHPLNKLQEAWRSVHYPPETASI--MLMARMVATVKQAKDKDHWVRLFSHFCSKTANEE---EE 203

  Fly   369 LI-SLPKDDFRRVAQLERHQGERQPSNFFQHVLMARFLTNCLRAGGY-------------FGSEP 419
            :: .|..|.|:...:|.|        ..|...|....|:......|:             .|:..
  Rat   204 IVHKLLGDKFKGQLELLR--------RLFTEALYEETLSQWFTPDGFRSLFALVGTNGQGIGTSS 260

  Fly   420 KPDEVSIICSLVLRSLQFIQFNTHEVAELHK--FSSSGREKSIFI---GGAIYPTLALFNHSCDP 479
            ....|....:|.|:..:..|.:|. :.:|:|  .:::|.    |:   |..::...:..||||.|
  Rat   261 LSQWVHACDALELKPQEREQLDTF-IDQLYKDIEAATGE----FLNCEGSGLFVLQSCCNHSCVP 320

  Fly   480 GVVRYF--RGTTIHINSVRPIEAGLPINENYGPMYTQDERS--ERQARLKDLYWFECSCDACI 538
            .....|  ....:|:.::..||.|..|..:|... .|.|||  .|...|::.|.|.|||..|:
  Rat   321 NAETSFPENNFLLHVTALEDIEPGEEICISYLDC-CQRERSRHSRHKILRENYLFVCSCPKCL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 17/63 (27%)
Smyd5NP_001101340.1 DUF4599 68..144 CDD:292015 20/76 (26%)
SET <298..351 CDD:214614 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.