DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-3 and SmydA-8

DIOPT Version :9

Sequence 1:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster


Alignment Length:441 Identity:89/441 - (20%)
Similarity:145/441 - (32%) Gaps:132/441 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 IDSNRQEGRFARASADVKPGEELLVERPFVS-VLLEKFAKTHCENC--------FM---RTVVPV 295
            |.|:...||...|:.|:..||.:..||..|: ....|...:.|..|        |:   |..:||
  Fly    59 ISSSTVAGRGVFATRDIAAGELIFQERALVTGPTARKGQLSSCICCHETLPQTGFLCRHRCTLPV 123

  Fly   296 ACPRCADVLYCSEQCREEASKKYHKYECGIVPIIWRSGASINNHIALRIIASKPLDYFLKLKP-T 359
             |..|:|    ||:         |:.||                           ::|.:.:| .
  Fly   124 -CETCSD----SEE---------HQAEC---------------------------EHFRRWQPKD 147

  Fly   360 ID---EELTPEQLISLPKDDFRRVAQLER--HQGERQPSNFFQHVLMA-------RFLTNCLRAG 412
            :|   |::.|..|         |:....|  |.|:.|     :|::.|       .:....::|.
  Fly   148 VDAEQEQVNPMSL---------RILTAVRVFHLGKEQ-----RHLVDAMQANAERAYRREIIQAA 198

  Fly   413 GYFGSEPKPDEVSIICSLVLRSLQFIQFNTHEVAELHKFSSSGREKSIFIGGAIYPTLALFNHSC 477
            ..|.:.|..|.|  ....:.|.:..:..|..|..     ..||..:::..|  ::|..|:.||.|
  Fly   199 QCFRNFPTTDRV--FMDQLFRIVGVLNTNAFEAP-----CRSGGHETLLRG--LFPLTAIMNHEC 254

  Fly   478 DPGVVRYF-RGTTIHINSVRPIEAGLPINENYGPMYTQDERSERQARLKDLYWFECSCDACIDNW 541
            .|....|| .|....:.:.|.|..|..|...|..:...:  ..|...||....|.|.|..|.|| 
  Fly   255 TPNASHYFENGRLAVVRAARDIPKGGEITTTYTKILWGN--LTRNIFLKMTKHFACDCVRCHDN- 316

  Fly   542 PKFDDLPRDVIRFRCDAPNNCSAVIEVPPSCNDFMV-----------KCVTCGEITNILKGLKVM 595
                          .:.....||:......|...::           :|:||   .|:....|:.
  Fly   317 --------------TENGTYLSALFCREQGCRGLVIPVQTRTLQPDWRCITC---ENVFPHAKMA 364

  Fly   596 QDTEMMTRTAKRLYETGEYPKALAKFVDLIRIMYEVLAPPFPDFCESQQHL 646
            :..:....|......:       ....|:|..:.|:.    |.||.|..::
  Fly   365 KYQDFALNTINNRINS-------CSVQDMIHFINELC----PRFCPSSNYV 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 12/49 (24%)
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 25/112 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.