DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-3 and Zmynd15

DIOPT Version :9

Sequence 1:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_001099270.1 Gene:Zmynd15 / 287457 RGDID:1309845 Length:738 Species:Rattus norvegicus


Alignment Length:212 Identity:43/212 - (20%)
Similarity:66/212 - (31%) Gaps:85/212 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 AKQEAKQQKQKIALDQAKPVKLE-----NEFVSPLVRIDSNRQEGRFARASADVKPGEELLVER- 269
            |:.|...:|:|....:|.|:.|.     .:....::.||. ..:|  |:.|....||.|.|..| 
  Rat   179 AEDERAPEKRKGRKTEAAPLHLSCLLLVTDEHGTILGIDL-LMDG--AQGSVGQSPGTENLAPRA 240

  Fly   270 --------------------------------------PFVSVLLEK-------------FAKTH 283
                                                  |.:.|.|.|             ||...
  Rat   241 YALLCHSMACPMGSGDPRKPRQLTVGDAHLHRELESLVPRLGVKLAKTPMRTWGPRPGFTFASLR 305

  Fly   284 CENC-------FMRTVVPVACPRCADVLYCSEQCREEASKK-----YHKYEC-GIVPIIWRSGAS 335
            ...|       |...:.|  ||:|:.||||.|.|.:...::     .|::.| .:...:.|:|. 
  Rat   306 ARTCHVCHKHSFEVKLTP--CPQCSAVLYCGEACLQADWRRCPDDVSHRFWCPRLAAFMERAGE- 367

  Fly   336 INNHIALRIIASKPLDY 352
                     :||.|..|
  Rat   368 ---------LASLPFTY 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 13/50 (26%)
Zmynd15NP_001099270.1 zf-MYND 309..355 CDD:280009 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.