DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-3 and Smyd5

DIOPT Version :9

Sequence 1:NP_725048.1 Gene:Smyd4-3 / 36234 FlyBaseID:FBgn0033633 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_659167.2 Gene:Smyd5 / 232187 MGIID:108048 Length:416 Species:Mus musculus


Alignment Length:368 Identity:90/368 - (24%)
Similarity:145/368 - (39%) Gaps:86/368 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 IDSNRQEGRFARASADVKPGEELLVERPFV------SVLLEKFAKTHC----------------- 284
            :||.:.:|.|  |:..::.||.:.:|||.|      :.|.:..|..||                 
Mouse    28 VDSIKGKGLF--ATQLIRKGETIFIERPLVAAQFLWNALYQYRACDHCLRALEKAEENAQRLTGK 90

  Fly   285 --------ENCFMRTVVPVACPRCADVLYCSEQCREEASKKYHKYEC-----------GIVPIIW 330
                    |.|.:|..:...||.| .|:|||.:||..|:::||:..|           ..:...|
Mouse    91 PSQILPHPELCSVRKDLHQNCPHC-QVMYCSAECRLAAAEQYHQILCPGPSHDPRHPLNKLQEAW 154

  Fly   331 RS------GASINNHIALRIIA----SKPLDYFLKL-KPTIDEELTPEQLI--SLPKDDFRRVAQ 382
            ||      .|||  .:..|::|    :|..|::::| ..........||.|  .|.|..|:  .|
Mouse   155 RSVHYPPETASI--MLMARMVATVKQAKDKDHWVRLFNHFCSRTANQEQAIVHKLLKGKFK--DQ 215

  Fly   383 LERHQGERQPSNFFQHVLMARFLTNCLRA--------GGYFGSEPKPDEVSIICSLVLRSLQFIQ 439
            ||...|..:.: .::..|...|.....|:        |...|:......|....:|.|......|
Mouse   216 LELLLGLFKEA-LYEEALSLWFTPEGFRSLFALVGTNGQGIGTSSLSQWVHACDALELTPQDREQ 279

  Fly   440 FNTHEVAELHK--FSSSGREKSIFI---GGAIYPTLALFNHSCDPGVVRYF--RGTTIHINSVRP 497
            .:|. :.:|:|  .:::|.    |:   |..::...:..||||.|.....|  ....:|:.::..
Mouse   280 LDTF-IDQLYKDIEAATGE----FLNCEGSGLFVLQSCCNHSCVPNAETSFPENNFVLHVTALED 339

  Fly   498 IEAGLPINENYGPMYTQDERS--ERQARLKDLYWFECSCDACI 538
            |:.|..|..:|... .|.|||  .|...|::.|.|.|||..|:
Mouse   340 IKPGEEICISYLDC-CQRERSRHSRHKILRENYLFNCSCPKCL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-3NP_725048.1 TPR_11 74..143 CDD:290150
TPR repeat 74..103 CDD:276809
TPR repeat 108..142 CDD:276809
TPR repeat 150..177 CDD:276809
zf-MYND 284..323 CDD:280009 16/63 (25%)
Smyd5NP_659167.2 SET <297..350 CDD:214614 12/56 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.