DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and SOD1

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_012638.1 Gene:SOD1 / 853568 SGDID:S000003865 Length:154 Species:Saccharomyces cerevisiae


Alignment Length:156 Identity:71/156 - (45%)
Similarity:95/156 - (60%) Gaps:6/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IQAIAYLIGPVQSDNTQVKGNVTFTQNDCGQNVHVRVQLEG-LKEGKHGFHIHEKGDLTNGCISM 89
            :||:|.|.|     :..|.|.|.|.|....:...|..::.| ....:.||||||.||.||||:|.
Yeast     2 VQAVAVLKG-----DAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSA 61

  Fly    90 GAHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDD 154
            |.|:||.|..||.|..|||||||:||::.:..|:...::.|.:|.|.|...::||.||:|..:||
Yeast    62 GPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDD 126

  Fly   155 LGLGNHTDSKKTGNAGGRIACGVIGI 180
            ||.|:..:|.||||||.|.||||||:
Yeast   127 LGKGDTEESLKTGNAGPRPACGVIGL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 63/136 (46%)
SOD1NP_012638.1 Sod_Cu 14..149 CDD:395033 62/134 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S341
OMA 1 1.010 - - QHG61834
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - LDO PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1078
TreeFam 00.000 Not matched by this tool.
98.700

Return to query results.
Submit another query.