DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and CSD3

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_197311.1 Gene:CSD3 / 831928 AraportID:AT5G18100 Length:164 Species:Arabidopsis thaliana


Alignment Length:155 Identity:76/155 - (49%)
Similarity:97/155 - (62%) Gaps:6/155 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IQAIAYLIGPVQSDNTQVKGNVTFTQNDCGQNVHVRVQLEGLKEGKHGFHIHEKGDLTNGCISMG 90
            ::|:|.:.|    || .|:|.:.|.| |.....||..::.||..|.||||||..||.||||||.|
plant     8 LRAVALIAG----DN-NVRGCLQFVQ-DISGTTHVTGKISGLSPGFHGFHIHSFGDTTNGCISTG 66

  Fly    91 AHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDL 155
            .|:||....||.|:.|.||.|||||:.|.|.|:.::...|:.|.|:|:..|:||.||||...|||
plant    67 PHFNPLNRVHGPPNEEERHAGDLGNILAGSNGVAEILIKDKHIPLSGQYSILGRAVVVHADPDDL 131

  Fly   156 GLGNHTDSKKTGNAGGRIACGVIGI 180
            |.|.|..||.|||||.|:.||:||:
plant   132 GKGGHKLSKSTGNAGSRVGCGIIGL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 69/135 (51%)
CSD3NP_197311.1 PLN02642 1..164 CDD:178248 76/155 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61834
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.