DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and sod3b

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_001332758.1 Gene:sod3b / 794006 ZFINID:ZDB-GENE-030131-8743 Length:192 Species:Danio rerio


Alignment Length:145 Identity:61/145 - (42%)
Similarity:80/145 - (55%) Gaps:11/145 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QVKGNVTFTQNDCGQNVHVRVQLEGL---KEGKHGFHIHEKGDLTNGCISMGAHYNPDKVDHGGP 103
            :|.|::.|.|:...:.:.|..:|.||   .:.....||||.|||:.||.|.|.||||..|:|   
Zfish    54 RVYGHILFRQSGPKEKLSVTFRLYGLPADSQQPRAMHIHEYGDLSRGCDSTGGHYNPLNVNH--- 115

  Fly   104 DHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLGLGNHTDSKKTGN 168
               .:|.||.||....:..|..  ..:...||.|||.|:||.||:||.:||||.|.:..|...||
Zfish   116 ---PQHPGDFGNFVPVNKKIRQ--SLESPATLFGKLSIVGRSVVIHEGKDDLGRGGNVGSLLNGN 175

  Fly   169 AGGRIACGVIGINGP 183
            ||||:||.|||:..|
Zfish   176 AGGRLACCVIGLRNP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 57/138 (41%)
sod3bXP_001332758.1 Sod_Cu 55..185 CDD:278508 57/137 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.