DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and SOD3

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_003093.2 Gene:SOD3 / 6649 HGNCID:11181 Length:240 Species:Homo sapiens


Alignment Length:148 Identity:57/148 - (38%)
Similarity:72/148 - (48%) Gaps:11/148 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QVKGNVTFTQNDCGQNVHVRVQLEGL----KEGKHGFHIHEKGDLTNGCISMGAHYNPDKVDHGG 102
            :|.|.|.|.|......:.....|||.    .......|:|:.|||:.||.|.|.||||..|.|  
Human    77 RVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPH-- 139

  Fly   103 PDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLGLGNHTDSKKTG 167
                .:|.||.||. |...|.:.........:|.|...|:||.||||..|||||.|.:..|.:.|
Human   140 ----PQHPGDFGNF-AVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENG 199

  Fly   168 NAGGRIACGVIGINGPSV 185
            |||.|:||.|:|:.||.:
Human   200 NAGRRLACCVVGVCGPGL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 53/139 (38%)
SOD3NP_003093.2 Sod_Cu 74..210 CDD:306566 53/139 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.